PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_F0688BFDE.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 309aa    MW: 32903.5 Da    PI: 7.7745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_F0688BFDE.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.42.2e-151462148
                           TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                           rg+W++eEde+l  +v+  G g +W + +++ g++R++k+c++rw++yl
  Traes_1AL_F0688BFDE.2 14 RGPWSPEEDEQLRSYVRANGVGgNWIALPHKAGLNRCGKSCRLRWLNYL 62
                           89******************999************************97 PP

2Myb_DNA-binding353.4e-1171111446
                            S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             T++Ed  +  + +  G++ W+ Ia++++ gRt++++k++w++
  Traes_1AL_F0688BFDE.2  71 YTEQEDRVICSLYASIGSR-WSIIASKLP-GRTDNDVKNYWNT 111
                            69*****************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.323966IPR017930Myb domain
SuperFamilySSF466892.37E-2611109IPR009057Homeodomain-like
SMARTSM007171.3E-111364IPR001005SANT/Myb domain
PfamPF002492.5E-141462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-221569IPR009057Homeodomain-like
CDDcd001671.43E-81662No hitNo description
SMARTSM007172.6E-1067115IPR001005SANT/Myb domain
PROSITE profilePS5129414.60767117IPR017930Myb domain
PfamPF002497.0E-1069111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2170116IPR009057Homeodomain-like
CDDcd001676.13E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGRAPCCDKA RVKRGPWSPE EDEQLRSYVR ANGVGGNWIA LPHKAGLNRC GKSCRLRWLN  60
YLRPDIRHGG YTEQEDRVIC SLYASIGSRW SIIASKLPGR TDNDVKNYWN TKLKKKAMPM  120
PMPMPMPGPH YHHHAGLGAF SAPATPSGPA GSWSQCVPST LQPAALSPAA SGSSVDTTSS  180
GGDMCFAPAG MYQPHHPMQG FVHVDSSPQT VLAPMPLDVP AATGIWAPSM PAASDVGGVA  240
LEDAFLADLG AYGDLLLGGF GGQLLQDNKA TAAMELPGAC YFPNMAEMWA ADHAHAHAKP  300
PQGLCNTFT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-25141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3581610.0AK358161.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1070D08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006654754.11e-104PREDICTED: transcription factor RAX1-like
TrEMBLW4ZU020.0W4ZU02_WHEAT; Uncharacterized protein
STRINGOB05G32650.11e-103(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49690.13e-68myb domain protein 84
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]